N/A
|
CAS Number: 106612-94-6\n Molecular Weight: 3353.68\n Salt Form: Acetate\n Purity: >96%\n Sequence (3-letter): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH\n Sequence (1-letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH\n Storage: -20 °C or below
|
Buy from Supplier |
94
|
Shanghai Korain Biotech Co Ltd
rat glp 1 Rat Glp 1, supplied by Shanghai Korain Biotech Co Ltd, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/control+peptides+human+glp+1+7+37/Human+Glucagon-like+Peptide+1/10__63594_slash_dmte__2026__0006-66-3-13 Average 94 stars, based on 1 article reviews
rat glp 1 - by Bioz Stars,
2026-10
94/100 stars
|
Buy from Supplier |
90
|
ELK Biotechnology
human glucagon-like peptide 1 (glp-1, 7-37) elisa kit elk5218 Human Glucagon Like Peptide 1 (Glp 1, 7 37) Elisa Kit Elk5218, supplied by ELK Biotechnology, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/control+peptides+human+glp+1+7+37/human+glucagon+like+peptide+1++glp+1++7+37++elisa+kit+elk5218/pm36867047__ja2c13762_si_001-49-40-49 Average 90 stars, based on 1 article reviews
human glucagon-like peptide 1 (glp-1, 7-37) elisa kit elk5218 - by Bioz Stars,
2026-10
90/100 stars
|
Buy from Supplier |